ShopDreamUp AI ArtDreamUp
Deviation Actions
barbarianblueblueeyecharmcollarcontroldarkdarkskinearringelfelvishenchantmenteyeeyeeyeseyesfemalefighterfurhairhoophypnohypnosisladyladymagelooplovelovespellmagemagusmaidenmcmidnightmidnightbluemindmindcontrolpuffyqueensilversilverhairskinsleevesspelltunicwhitewhitesilverfemaleladyhairdarkwhitesilverhair
Description
A world is plagued by an ever-expanding Empire of the glorious Dharvan Race, wasting no time in plowing through each and every nation in their way of world conquest, whether they be neutral nations, hostile nomads, or rival expansionists. Many were felled by their hand. Even those considered superior in military or technological might, and the later defeated would only serve to make them stronger.
This persisted until they struck out against a settled nation skilled at arcane arts and psionics. Their surprise raid on a peaceful resource town angered governing heads, and in retaliation, sent a powerful unit after them. The raiding party requested backup and received help from one of their Empire's mightiest generals, an apparent female of some renown. However, her unit was met with much resistance, her army was annihilated, and she herself was taken captive.
As the governing heads pondered whether to eradicate the invading Dharvan to complete their retribution and restore order, one particular lord decides to make the captive into a woman more to his liking: a refined, gracious disciple eager to assist her new master in his studies and experiments.
After her new persona was established, she was bestowed information of her master's current projects, as well essential knowledge of the mystic arts and psionics, through a sort of "psychic linking". With this, she can hear and feel her Master's thoughts and orders with ease. As far as she knows, she has always been this way, and seems to hold a sense of pride in her position.
----------------------
Something of a pseudo-followup to Way of Total Defeat and another "patchwork" combining two old colored drawings into one submission, which also patches together two pieces of story from seperate artist's comments with a few edits. Also consider it a predecessor sequence to Verily Milord, only involving more of a morally grey situation instead of a clearly evil lord brainwashing a brash anti-hero.
The Dharvan Race and Empire were inspired by the Mongolian Empire and the Drow (Elves), though liberties were likely taken to make them more distinct from both.
This persisted until they struck out against a settled nation skilled at arcane arts and psionics. Their surprise raid on a peaceful resource town angered governing heads, and in retaliation, sent a powerful unit after them. The raiding party requested backup and received help from one of their Empire's mightiest generals, an apparent female of some renown. However, her unit was met with much resistance, her army was annihilated, and she herself was taken captive.
As the governing heads pondered whether to eradicate the invading Dharvan to complete their retribution and restore order, one particular lord decides to make the captive into a woman more to his liking: a refined, gracious disciple eager to assist her new master in his studies and experiments.
After her new persona was established, she was bestowed information of her master's current projects, as well essential knowledge of the mystic arts and psionics, through a sort of "psychic linking". With this, she can hear and feel her Master's thoughts and orders with ease. As far as she knows, she has always been this way, and seems to hold a sense of pride in her position.
----------------------
Something of a pseudo-followup to Way of Total Defeat and another "patchwork" combining two old colored drawings into one submission, which also patches together two pieces of story from seperate artist's comments with a few edits. Also consider it a predecessor sequence to Verily Milord, only involving more of a morally grey situation instead of a clearly evil lord brainwashing a brash anti-hero.
The Dharvan Race and Empire were inspired by the Mongolian Empire and the Drow (Elves), though liberties were likely taken to make them more distinct from both.
Image size
1000x618px 663.87 KB
© 2015 - 2024 Chicken-Yuki
Comments6
Join the community to add your comment. Already a deviant? Log In
Lovely!~